PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4553s0022.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LFY
Protein Properties Length: 427aa    MW: 47157.8 Da    PI: 6.786
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4553s0022.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY617.52.4e-18813951386
              FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlm 90 
                          mdpe f++ lf+w+p  a++++p  + + + ++++p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++m
  Cagra.4553s0022.1.p   1 MDPEGFTSGLFRWNPMRAMVQAPPPVPP-SPQQQQPVTPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEMM 89 
                          9*************77776665555544.44556666777888888899***************************************** PP

              FLO_LFY  91 kslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqe....glseepvqeekeaagsggeglg 169
                          +sls+ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll      + +++aldalsqe    glseepvq++ ++ ++g++g g
  Cagra.4553s0022.1.p  90 NSLSHIFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaagDSGTHHALDALSQEddwtGLSEEPVQQQDQTDAAGNNGGG 179
                          ******************************99544456778887778844344556*******988889*******97776666666655 PP

              FLO_LFY 170 eaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg.....sgedgeerqrehPfivtepgevargkknGLDYLfd 254
                           ++   + ++k    kk++ + +++ kk   ++ e+d+d +e ed+d+++     +g  g+erqrehPfivtepgevargkknGLDYLf+
  Cagra.4553s0022.1.p 180 GSGYWESGQAK---MKKQQ-Q-RRR-KKPMVASVETDDDGNEGEDDDGMDngnggGGGMGTERQREHPFIVTEPGEVARGKKNGLDYLFH 263
                          66665555322...22222.2.222.22222233344444444443333312222555677***************************** PP

              FLO_LFY 255 LyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykpl 344
                          LyeqCrefLlqvq+iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde+asnalrr+fkergenvG+wrqacykpl
  Cagra.4553s0022.1.p 264 LYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRSFKERGENVGSWRQACYKPL 353
                          ****************************************************************************************** PP

              FLO_LFY 345 vaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                          v+ia r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  Cagra.4553s0022.1.p 354 VNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 395
                          **************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016988.5E-1991394IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPMRAMV QAPPPVPPSP QQQQPVTPQT AAFGMRLGGL EGLFGAYGIR  60
FYTAAKIAEL GFTASTLVGM KDEELEEMMN SLSHIFRWEL LVGERYGIKA AVRAERRRLQ  120
EEEEEESSRR RHLLLSAAGD SGTHHALDAL SQEDDWTGLS EEPVQQQDQT DAAGNNGGGG  180
SGYWESGQAK MKKQQQRRRK KPMVASVETD DDGNEGEDDD GMDNGNGGGG GMGTERQREH  240
PFIVTEPGEV ARGKKNGLDY LFHLYEQCRE FLLQVQTIAK DRGEKCPTKV TNQVFRYAKK  300
SGASYINKPK MRHYVHCYAL HCLDEDASNA LRRSFKERGE NVGSWRQACY KPLVNIACRH  360
GWDIDAVFNA HPRLSIWYVP TKLRQLCHLE RNNAVAAAAA LVGGGISCTG SSTSGRGGCG  420
GDELRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1362324261194PROTEIN LEAFY
2vy2_A1e-1362324261194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4719320.0DQ471932.1 Brassica juncea cultivar Varuna LEAFY transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010457875.10.0PREDICTED: protein LEAFY isoform X1
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ6XPU80.0Q6XPU8_IONAC; LEAFY-like protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)